(data stored in ACNUC7421 zone)

EMBL: CP001791.PE76

CP001791.PE76        Location/Qualifiers
FT   CDS             101687..102397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0079"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: pca:Pcar_1965
FT                   putative MgtC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97628"
FT                   /db_xref="GOA:D6XV70"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV70"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ADH97628.1"
FT                   /translation="MDWSFLMTEDIDVMMIRLVMAAILGGLVGIEREYNHHPAGFRTHL
FT                   LVSVGSCLMMLLAFYGFQDYIAANEGNVNFDPSRLAAYVVSGIGFLGAGTILVQGSSVK
FT                   GLTTAASIWVVAGIGLTVGAGMYGPALIATLIVIISLFILAKVNFRISAEEKEEALMVK
FT                   LDGEMGRLGDVISILDGLGINVSFVSSEKQQAYHEKSMVEYRLVVEYKQWSDIYEAMET
FT                   IQQLDPVQSVSLDQ"
     MDWSFLMTED IDVMMIRLVM AAILGGLVGI EREYNHHPAG FRTHLLVSVG SCLMMLLAFY        60
     GFQDYIAANE GNVNFDPSRL AAYVVSGIGF LGAGTILVQG SSVKGLTTAA SIWVVAGIGL       120
     TVGAGMYGPA LIATLIVIIS LFILAKVNFR ISAEEKEEAL MVKLDGEMGR LGDVISILDG       180
     LGINVSFVSS EKQQAYHEKS MVEYRLVVEY KQWSDIYEAM ETIQQLDPVQ SVSLDQ           236
//

If you have problems or comments...

PBIL Back to PBIL home page