(data stored in ACNUC7421 zone)

EMBL: CP001791.PE77

CP001791.PE77        Location/Qualifiers
FT   CDS             102499..102975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0080"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97629"
FT                   /db_xref="GOA:D6XV71"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV71"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADH97629.1"
FT                   /translation="MRNISDVIEGYLKQIIEKNDQELIEVKRSELAEQFDCVPSQINYV
FT                   IRTRFTVEKGYMVQSKRGGGGYIRITRVTPDNHLQLYDQLIDLSGDEISQTAAMHLIGR
FT                   LLEEEAITKREANLMESVMNREVLSIRLPYRDRLRAELLKAMLTTLKYKELEDS"
     MRNISDVIEG YLKQIIEKND QELIEVKRSE LAEQFDCVPS QINYVIRTRF TVEKGYMVQS        60
     KRGGGGYIRI TRVTPDNHLQ LYDQLIDLSG DEISQTAAMH LIGRLLEEEA ITKREANLME       120
     SVMNREVLSI RLPYRDRLRA ELLKAMLTTL KYKELEDS                               158
//

If you have problems or comments...

PBIL Back to PBIL home page