(data stored in ACNUC7421 zone)

EMBL: CP001791.PE79

CP001791.PE79        Location/Qualifiers
FT   CDS             103535..104632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0082"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97631"
FT                   /db_xref="GOA:D6XV73"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV73"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADH97631.1"
FT                   /translation="MSLQSFISEAISPWMKNEGPESDIVISTRVRLARNEAHTAFPIAA
FT                   MNDRLEEVLNRVKQNFAGRSHRRFGELELLAMTDLSPNERRMLVEKHLISPNLAAGEHG
FT                   SGVLLSEDESLSVMINEEDHYRIQCLMSGFQLDACLKYANAMDDWMEEKVDFAFHENRG
FT                   YLTSCPTNVGTGLRSSVMMHLPALVLTNQFNRIVPAISQLGLVVRGIYGEGSEALGNLF
FT                   QISNQTTLGKTEADIVDNLKGVVKQLIQHERAARQTLYEQSQLFLEDRVYRSLGTLAYS
FT                   RRMETQEAMQRLSDVRLGIDLGIINHMQGKILNELMVLTQPGFLQHYAEQELSAEERDE
FT                   RRATFIRERLQLEKKNDHTNGGGQP"
     MSLQSFISEA ISPWMKNEGP ESDIVISTRV RLARNEAHTA FPIAAMNDRL EEVLNRVKQN        60
     FAGRSHRRFG ELELLAMTDL SPNERRMLVE KHLISPNLAA GEHGSGVLLS EDESLSVMIN       120
     EEDHYRIQCL MSGFQLDACL KYANAMDDWM EEKVDFAFHE NRGYLTSCPT NVGTGLRSSV       180
     MMHLPALVLT NQFNRIVPAI SQLGLVVRGI YGEGSEALGN LFQISNQTTL GKTEADIVDN       240
     LKGVVKQLIQ HERAARQTLY EQSQLFLEDR VYRSLGTLAY SRRMETQEAM QRLSDVRLGI       300
     DLGIINHMQG KILNELMVLT QPGFLQHYAE QELSAEERDE RRATFIRERL QLEKKNDHTN       360
     GGGQP                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page