(data stored in ACNUC7421 zone)

EMBL: CP001791.PE8

CP001791.PE8         Location/Qualifiers
FT   CDS             9990..11099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0008"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sse:Ssed_1799 metal dependent phosphohydrolase
FT                   domain-containing protein; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97560"
FT                   /db_xref="GOA:D6XV02"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV02"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADH97560.1"
FT                   /translation="MHVHVNKLIPGCVLREDVYVKTASPVMKRKTVLTDDHIYILEKFL
FT                   VEDVEVFQKLANGQVFNPAGGIKEEQDDTPNDEDDQATIEKDSFLDRYLTAVQSYKKHF
FT                   KNWQAGAKIEAYDVRKIFLPLYEREPNKYELMQLLALSTKQEYTYHHAVAVSIFSYLIG
FT                   KAEGLKSGEVIQLGLSGLLSDCGMAKLPFSVSSKTGSLTAEEYDEIKKHPIYGYRMLES
FT                   VPGFSKNALLGVLQHHEREDGSGYPLQVKRDKLHPFAKIIAIADTYHAMTSERPYRSAK
FT                   SPYHVMDELLMDGFGKLDHHLIHKLIPMLTDLSIGDRVVLNNDMAGEVVFLNQERPTKP
FT                   VVRLDNDKQIDLIKERDVHIEYLVSNASS"
     MHVHVNKLIP GCVLREDVYV KTASPVMKRK TVLTDDHIYI LEKFLVEDVE VFQKLANGQV        60
     FNPAGGIKEE QDDTPNDEDD QATIEKDSFL DRYLTAVQSY KKHFKNWQAG AKIEAYDVRK       120
     IFLPLYEREP NKYELMQLLA LSTKQEYTYH HAVAVSIFSY LIGKAEGLKS GEVIQLGLSG       180
     LLSDCGMAKL PFSVSSKTGS LTAEEYDEIK KHPIYGYRML ESVPGFSKNA LLGVLQHHER       240
     EDGSGYPLQV KRDKLHPFAK IIAIADTYHA MTSERPYRSA KSPYHVMDEL LMDGFGKLDH       300
     HLIHKLIPML TDLSIGDRVV LNNDMAGEVV FLNQERPTKP VVRLDNDKQI DLIKERDVHI       360
     EYLVSNASS                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page