(data stored in ACNUC7421 zone)

EMBL: CP001791.PE81

CP001791.PE81        Location/Qualifiers
FT   CDS             107163..108575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0084"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: dal:Dalk_2956 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97633"
FT                   /db_xref="GOA:D6XV75"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV75"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADH97633.1"
FT                   /translation="MAKKKTKFICQECGYESAKWMGKCPGCSGWNTLVEEMEKPASSAH
FT                   EKRSFVTAGGGIRQKPQSIMDIEQKEENRVSTYINELNRVLGGGIVPGSLVLVGGDPGI
FT                   GKSTLLLQVSATLSEHKKKVLYISGEESLKQTKLRANRLGVGNDYLFVHSETDVEYIEQ
FT                   AIDQVNPDLVIIDSIQTVYLDHITSAPGSVSQVRESTSVFMRIAKTRGIAIFLVGHVTK
FT                   QGSIAGPRILEHMVDSVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMKETGLEEVLN
FT                   PSEIFLEERSSGASGSAVVASMEGTRPVLVEMQSLIAPTSFGNPRRMATGVDHNRISLI
FT                   MAVLEKRAGILLQNHDAYVKVAGGVRLDEPSIDLAIAISIVSSFRDQPSRAGDVIIGEV
FT                   GLTGEIRRVSRIEQRVQEAAKLGFERVIIPDRNFGGWTVPDGIEVIGARDINEAINEAL
FT                   GGRASGAPKFEL"
     MAKKKTKFIC QECGYESAKW MGKCPGCSGW NTLVEEMEKP ASSAHEKRSF VTAGGGIRQK        60
     PQSIMDIEQK EENRVSTYIN ELNRVLGGGI VPGSLVLVGG DPGIGKSTLL LQVSATLSEH       120
     KKKVLYISGE ESLKQTKLRA NRLGVGNDYL FVHSETDVEY IEQAIDQVNP DLVIIDSIQT       180
     VYLDHITSAP GSVSQVREST SVFMRIAKTR GIAIFLVGHV TKQGSIAGPR ILEHMVDSVL       240
     YFEGERHHTY RILRAVKNRF GSTNEIGIFE MKETGLEEVL NPSEIFLEER SSGASGSAVV       300
     ASMEGTRPVL VEMQSLIAPT SFGNPRRMAT GVDHNRISLI MAVLEKRAGI LLQNHDAYVK       360
     VAGGVRLDEP SIDLAIAISI VSSFRDQPSR AGDVIIGEVG LTGEIRRVSR IEQRVQEAAK       420
     LGFERVIIPD RNFGGWTVPD GIEVIGARDI NEAINEALGG RASGAPKFEL                  470
//

If you have problems or comments...

PBIL Back to PBIL home page