(data stored in ACNUC7421 zone)

EMBL: CP001791.PE84

CP001791.PE84        Location/Qualifiers
FT   CDS             110911..111615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0087"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: ppd:Ppro_2969 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97636"
FT                   /db_xref="GOA:D6XV78"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV78"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADH97636.1"
FT                   /translation="MKPYKAVIPAAGQGSRMKAGHNKQFIHIGHDPLLVHTLRVFQEDS
FT                   SCQGIVVSVNPSEMASVQTLIDEAGITKVETLTAGGKERQESVYLGLKKLSGNPVVLIH
FT                   DGARPFIDQGAIKRLTAAVEPGVGVVVGVPVKDTIKRTREHIVQETLKRDELWSIQTPQ
FT                   GFLLTDILAAHAHAEEQGFPATDDASVFEFSGRPVKVVEGNYANIKVTTPEDLIFAEAI
FT                   LRSRSKNQQEKE"
     MKPYKAVIPA AGQGSRMKAG HNKQFIHIGH DPLLVHTLRV FQEDSSCQGI VVSVNPSEMA        60
     SVQTLIDEAG ITKVETLTAG GKERQESVYL GLKKLSGNPV VLIHDGARPF IDQGAIKRLT       120
     AAVEPGVGVV VGVPVKDTIK RTREHIVQET LKRDELWSIQ TPQGFLLTDI LAAHAHAEEQ       180
     GFPATDDASV FEFSGRPVKV VEGNYANIKV TTPEDLIFAE AILRSRSKNQ QEKE             234
//

If you have problems or comments...

PBIL Back to PBIL home page