(data stored in ACNUC7421 zone)

EMBL: CP001791.PE86

CP001791.PE86        Location/Qualifiers
FT   CDS             112188..113642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0089"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: glutamyl-tRNA synthetase family protein;
FT                   K01885 glutamyl-tRNA synthetase; TIGRFAM: glutamyl-tRNA
FT                   synthetase; PFAM: Glutamyl/glutaminyl-tRNA synthetase,
FT                   class Ic, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97638"
FT                   /db_xref="GOA:D6XV80"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV80"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADH97638.1"
FT                   /translation="MSNDIRVRFAPSPTGHLHIGGARSALFNYLFARNQGGKFIVRIED
FT                   TDQARNVETATEKLMESMKWLGIDWDESVDVGGPHAPYRSMERLDLYNRYVDQLLKEGK
FT                   AFHCYMTEEELEAEREEQRKRGETPMYSGRDRHLTDEQKRAYEAEGKKPVVRFMVPKGQ
FT                   EIVVDDAVRGKVTFDSDGIGDFVIVRTDGIPTYNFAVTVDDHTMGISHVIRGEEHLSNA
FT                   PLQVMLYEALGFETPTFAHASLILNEDRQKMSKRDESIIQFVEQYRDLGYMPEAIVNFI
FT                   ALLGWSPGGEQEIMTKNELIEAFSLDRVVKAPAVFDTKKLSWMNNQYMKEADDDQVVWL
FT                   AQPHLQKAGKLPEMMSDEQKQWAYDLIVLHKEKMDCGADIVPLTELFFQDEIEYDEDAK
FT                   AILGEEQVPEVLEAFLKNLDSLEEFEAAAIKKAMKDVQKSTGHKGKKLFMPIRVAVSGQ
FT                   QHGPDLPQMIALLGRTVVTTRLKGLL"
     MSNDIRVRFA PSPTGHLHIG GARSALFNYL FARNQGGKFI VRIEDTDQAR NVETATEKLM        60
     ESMKWLGIDW DESVDVGGPH APYRSMERLD LYNRYVDQLL KEGKAFHCYM TEEELEAERE       120
     EQRKRGETPM YSGRDRHLTD EQKRAYEAEG KKPVVRFMVP KGQEIVVDDA VRGKVTFDSD       180
     GIGDFVIVRT DGIPTYNFAV TVDDHTMGIS HVIRGEEHLS NAPLQVMLYE ALGFETPTFA       240
     HASLILNEDR QKMSKRDESI IQFVEQYRDL GYMPEAIVNF IALLGWSPGG EQEIMTKNEL       300
     IEAFSLDRVV KAPAVFDTKK LSWMNNQYMK EADDDQVVWL AQPHLQKAGK LPEMMSDEQK       360
     QWAYDLIVLH KEKMDCGADI VPLTELFFQD EIEYDEDAKA ILGEEQVPEV LEAFLKNLDS       420
     LEEFEAAAIK KAMKDVQKST GHKGKKLFMP IRVAVSGQQH GPDLPQMIAL LGRTVVTTRL       480
     KGLL                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page