(data stored in ACNUC7421 zone)

EMBL: CP001791.PE88

CP001791.PE88        Location/Qualifiers
FT   CDS             114665..116068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0091"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   gme:Gmet_0057 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia; Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97640"
FT                   /db_xref="GOA:D6XV82"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV82"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADH97640.1"
FT                   /translation="MTIQLYNTLTRQKETFQPIEEGKVKMYVCGPTVYNYIHIGNARPA
FT                   VVFDMVRRYLEYRGYDVTYVSNFTDVDDKIIKAANELDEDVMTVAERYIAAYYNDTEAL
FT                   GVRKADLHPRVTESMDDIITFITRLIDKGYAYESSGDVYFRTRKFDTYGQLSQQSLDDL
FT                   QAGARIQVEEKKEDPLDFVLWKTAKEGEIAWSSPWGEGRPGWHIECSAMVKKHLGDTID
FT                   IHAGGQDLSFPHHENEIAQSEALNEQRMANYWIHNGYINIDNEKMSKSLNNFILVHDII
FT                   RQFDPDVVRFFIVNAHYRSPINFSDEQLETAKTSLERIQTTYENLTYRLGESADLGGGQ
FT                   DKWFALIRKEGERFIASMDDDFNSANAVAVMFDLVRQANIYLTEKHTSKEVLEAFLKQF
FT                   DDMAFVLGIAVKRQAELLDEDVEQLIEERIQARKDRDFARADEIRDSLKDQGIILEDTP
FT                   QGTRWKRGS"
     MTIQLYNTLT RQKETFQPIE EGKVKMYVCG PTVYNYIHIG NARPAVVFDM VRRYLEYRGY        60
     DVTYVSNFTD VDDKIIKAAN ELDEDVMTVA ERYIAAYYND TEALGVRKAD LHPRVTESMD       120
     DIITFITRLI DKGYAYESSG DVYFRTRKFD TYGQLSQQSL DDLQAGARIQ VEEKKEDPLD       180
     FVLWKTAKEG EIAWSSPWGE GRPGWHIECS AMVKKHLGDT IDIHAGGQDL SFPHHENEIA       240
     QSEALNEQRM ANYWIHNGYI NIDNEKMSKS LNNFILVHDI IRQFDPDVVR FFIVNAHYRS       300
     PINFSDEQLE TAKTSLERIQ TTYENLTYRL GESADLGGGQ DKWFALIRKE GERFIASMDD       360
     DFNSANAVAV MFDLVRQANI YLTEKHTSKE VLEAFLKQFD DMAFVLGIAV KRQAELLDED       420
     VEQLIEERIQ ARKDRDFARA DEIRDSLKDQ GIILEDTPQG TRWKRGS                     467
//

If you have problems or comments...

PBIL Back to PBIL home page