(data stored in ACNUC7421 zone)

EMBL: CP001791.PE89

CP001791.PE89        Location/Qualifiers
FT   CDS             116072..116497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0092"
FT                   /product="ribonuclease III"
FT                   /note="KEGG: hypothetical protein; PFAM: ribonuclease III;
FT                   SMART: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97641"
FT                   /db_xref="GOA:D6XV83"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV83"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADH97641.1"
FT                   /translation="MDLNETVNEPEQLNALALAYMGDGVFDVYIRYRLISQGQVRPNQL
FT                   HRRATAYVSAKAQALILYSMQEQGVLREEEEAVVRRGRNAKSGTIPKHTDQQTYRMSTA
FT                   FEALIGYLYLTKQHERMDELIQYAVDWIEGKEELSHD"
     MDLNETVNEP EQLNALALAY MGDGVFDVYI RYRLISQGQV RPNQLHRRAT AYVSAKAQAL        60
     ILYSMQEQGV LREEEEAVVR RGRNAKSGTI PKHTDQQTYR MSTAFEALIG YLYLTKQHER       120
     MDELIQYAVD WIEGKEELSH D                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page