(data stored in ACNUC7421 zone)

EMBL: CP001791.PE9

CP001791.PE9         Location/Qualifiers
FT   CDS             complement(16705..17337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97561"
FT                   /db_xref="GOA:D6XV03"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97561.1"
FT                   /translation="MTIDDYLHEFQSRLTYVSEKEQTKIKYDIRSEIEQIKENLLEHEE
FT                   LDEEEAEHQAVASYLSPADMAQEINDQYFESIDEQFSGRSIAFIFVLSVILTPLGILII
FT                   PFVTGSFNGFSDQLIPRLVFMLIAALILFFYYPKHITSEQLRSLRQIFVVLYWYPVILV
FT                   FAFVLNLFRSDGFSMNLTLYLAVSLFIWLLILFGTRIFYQKQLNKPL"
     MTIDDYLHEF QSRLTYVSEK EQTKIKYDIR SEIEQIKENL LEHEELDEEE AEHQAVASYL        60
     SPADMAQEIN DQYFESIDEQ FSGRSIAFIF VLSVILTPLG ILIIPFVTGS FNGFSDQLIP       120
     RLVFMLIAAL ILFFYYPKHI TSEQLRSLRQ IFVVLYWYPV ILVFAFVLNL FRSDGFSMNL       180
     TLYLAVSLFI WLLILFGTRI FYQKQLNKPL                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page