(data stored in ACNUC7421 zone)

EMBL: CP001791.PE90

CP001791.PE90        Location/Qualifiers
FT   CDS             116490..117257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0093"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: afw:Anae109_2230 RNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97642"
FT                   /db_xref="GOA:D6XV84"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV84"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADH97642.1"
FT                   /translation="MTDANQDYVYGKNPVIEVLRSGQTVHKVWIAEDSMKGQMNQVLGL
FT                   CKKMNVQVQTVPRKRLDQMADGIAHQGVIAQAAAYEYAEIDDLFARAKERGEDPFFLVL
FT                   DELEDPHNLGSILRTADASGAHGVIIPKRRSVGLTSTVAKTSAGAIAHVPVARVTNLAR
FT                   TMDELKKQGLWFVGTDAKGDVSYEGMTVDLPLALVIGSEGKGMSRLVKEKCDFLVSIPL
FT                   MGKVTSLNASVAASLLMYEVLRKRRELGMGADA"
     MTDANQDYVY GKNPVIEVLR SGQTVHKVWI AEDSMKGQMN QVLGLCKKMN VQVQTVPRKR        60
     LDQMADGIAH QGVIAQAAAY EYAEIDDLFA RAKERGEDPF FLVLDELEDP HNLGSILRTA       120
     DASGAHGVII PKRRSVGLTS TVAKTSAGAI AHVPVARVTN LARTMDELKK QGLWFVGTDA       180
     KGDVSYEGMT VDLPLALVIG SEGKGMSRLV KEKCDFLVSI PLMGKVTSLN ASVAASLLMY       240
     EVLRKRRELG MGADA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page