(data stored in ACNUC7421 zone)

EMBL: CP001791.PE91

CP001791.PE91        Location/Qualifiers
FT   CDS             117250..117759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0094"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   hypothetical protein; K06962"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97643"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV85"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADH97643.1"
FT                   /translation="MRNILLVDGYNIIGDWVELRDLQKTDLEGARDQLIEKMAEYQAYT
FT                   GTEVIIVFDAHMVPGLGKSYRNFSVEILYTREKETADERIEKLVTELKRVDTKIYVATS
FT                   DFVEQRVIFASGAYRKSARELRTEVSQLEKKIASDVSRTKATKLRGGIPINDEVKKMFE
FT                   RMRRGK"
     MRNILLVDGY NIIGDWVELR DLQKTDLEGA RDQLIEKMAE YQAYTGTEVI IVFDAHMVPG        60
     LGKSYRNFSV EILYTREKET ADERIEKLVT ELKRVDTKIY VATSDFVEQR VIFASGAYRK       120
     SARELRTEVS QLEKKIASDV SRTKATKLRG GIPINDEVKK MFERMRRGK                   169
//

If you have problems or comments...

PBIL Back to PBIL home page