(data stored in ACNUC7421 zone)

EMBL: CP001791.PE97

CP001791.PE97        Location/Qualifiers
FT   CDS             121454..121987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0100"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain protein; KEGG: cvi:CV_4198
FT                   transcription antitermination protein NusG; SMART: NGN
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97649"
FT                   /db_xref="GOA:D6XV91"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV91"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADH97649.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKTNLEKRVESMEMTDKIFRILVPVEEE
FT                   NEVKNGKSKVVTKKVFPGYVIVEMVMTDDSWYVVRNTPGVTGFVGSTGAGSKPTALLPD
FT                   EADAILRQMGVEAPKAEVDFDLKESVKVKEGPFANFIGSIEDISAEKRKLKVHVNMFGR
FT                   ETPVELDFHQVEKI"
     MEKNWYVVHT YSGYENKVKT NLEKRVESME MTDKIFRILV PVEEENEVKN GKSKVVTKKV        60
     FPGYVIVEMV MTDDSWYVVR NTPGVTGFVG STGAGSKPTA LLPDEADAIL RQMGVEAPKA       120
     EVDFDLKESV KVKEGPFANF IGSIEDISAE KRKLKVHVNM FGRETPVELD FHQVEKI          177
//

If you have problems or comments...

PBIL Back to PBIL home page