(data stored in ACNUC7421 zone)

EMBL: CP001791.PE98

CP001791.PE98        Location/Qualifiers
FT   CDS             122120..122587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0101"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: ribosomal
FT                   protein L11; KEGG: gur:Gura_1057 50S ribosomal protein L11;
FT                   SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97650"
FT                   /db_xref="GOA:D6XV92"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV92"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADH97650.1"
FT                   /translation="MLGLPHHGLKEVCRVAKKVIKVVKLQIPAGKANPAPPVGPALGQA
FT                   GVNIMGFCKEFNARTQEDAGLIIPVEITVFEDRSFTFITKTPPAAVLLKKAAGIDSGSG
FT                   EPNKNKVATIKRDKVKEIAETKMPDLNAADVEAAMRMVEGTARSMGIVVED"
     MLGLPHHGLK EVCRVAKKVI KVVKLQIPAG KANPAPPVGP ALGQAGVNIM GFCKEFNART        60
     QEDAGLIIPV EITVFEDRSF TFITKTPPAA VLLKKAAGID SGSGEPNKNK VATIKRDKVK       120
     EIAETKMPDL NAADVEAAMR MVEGTARSMG IVVED                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page