(data stored in ACNUC7421 zone)

EMBL: CP001825.PE10

CP001825.PE10        Location/Qualifiers
FT   CDS             10710..11282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0010"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   aba:Acid345_1412 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40934"
FT                   /db_xref="GOA:D1CDC8"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC8"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACZ40934.1"
FT                   /translation="MNRQEAWELLNEYVKSPNLIRHCLAVEAAVRGYARLYGEDEELWG
FT                   LAGLLHDFDYEIHPTLDQHPSMGKPILEARGVPQEVIYAIQSHSDFTGVPRVHLLDKVL
FT                   YASDEISGFIVAVALVKPSRSIHEVDVKSVKKKLKDKAFARNVNRDDIYRGAEELGVDL
FT                   DTHIANVIEFLKPISDELTPKEQNVSR"
     MNRQEAWELL NEYVKSPNLI RHCLAVEAAV RGYARLYGED EELWGLAGLL HDFDYEIHPT        60
     LDQHPSMGKP ILEARGVPQE VIYAIQSHSD FTGVPRVHLL DKVLYASDEI SGFIVAVALV       120
     KPSRSIHEVD VKSVKKKLKD KAFARNVNRD DIYRGAEELG VDLDTHIANV IEFLKPISDE       180
     LTPKEQNVSR                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page