(data stored in ACNUC7421 zone)

EMBL: CP001825.PE102

CP001825.PE102       Location/Qualifiers
FT   CDS             115384..116151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0104"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ppd:Ppro_2693 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41026"
FT                   /db_xref="GOA:D1CDM0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ41026.1"
FT                   /translation="MTEGRPFISVIIPAYNEAKRLPVTIPRIVSFLSSQGWQYELIVVD
FT                   DGSTDETQQIACQLSKEYPSIRLLKLPHRGKGPAVREGVLASTGDLVLFTDADLSTPIS
FT                   QLSKLLARIEQGYDIAIGSREGVGARRYKEPFYRHLMGRVFNLFVRLLTLAHFNDTQCG
FT                   FKLFRKHAAKDIFSNLVLYGSTAPAIKGPMVTSLDVEVLQIAARRGYKVAEVPVEWHYS
FT                   SGSKVRPALDSYRMLKDIIRIKLNDLRGMYDKK"
     MTEGRPFISV IIPAYNEAKR LPVTIPRIVS FLSSQGWQYE LIVVDDGSTD ETQQIACQLS        60
     KEYPSIRLLK LPHRGKGPAV REGVLASTGD LVLFTDADLS TPISQLSKLL ARIEQGYDIA       120
     IGSREGVGAR RYKEPFYRHL MGRVFNLFVR LLTLAHFNDT QCGFKLFRKH AAKDIFSNLV       180
     LYGSTAPAIK GPMVTSLDVE VLQIAARRGY KVAEVPVEWH YSSGSKVRPA LDSYRMLKDI       240
     IRIKLNDLRG MYDKK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page