(data stored in ACNUC7421 zone)

EMBL: CP001825.PE104

CP001825.PE104       Location/Qualifiers
FT   CDS             116484..117356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0106"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding; KEGG: bur:Bcep18194_A4157
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41028"
FT                   /db_xref="GOA:D1CDM2"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM2"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACZ41028.1"
FT                   /translation="MKKEPSFGKVLIVGLGLIGGSIGLALTDNRVEVRGVTRSVSTLEE
FT                   ALRRGAITGGSTRLEDEAPHADLIILAAPTRTSINLITDLAQLAKEGTVITDVCSSKVD
FT                   VVRAMNQLPRHLRAVGGHPMAGKETPGISAAEKDLFLNSRWVLTETKRSDQESKSICEE
FT                   LAKLCGANVLWLDAEEHDLAVAYISHLPLLTSAALVLAAEEADTELTHKLAATGFRDST
FT                   RLAAGDHQMGVDLILTNSRNILQAINMFAHELQRMADAIEAGDEGKLRSLLEEAANIRR
FT                   NRYYKDNTH"
     MKKEPSFGKV LIVGLGLIGG SIGLALTDNR VEVRGVTRSV STLEEALRRG AITGGSTRLE        60
     DEAPHADLII LAAPTRTSIN LITDLAQLAK EGTVITDVCS SKVDVVRAMN QLPRHLRAVG       120
     GHPMAGKETP GISAAEKDLF LNSRWVLTET KRSDQESKSI CEELAKLCGA NVLWLDAEEH       180
     DLAVAYISHL PLLTSAALVL AAEEADTELT HKLAATGFRD STRLAAGDHQ MGVDLILTNS       240
     RNILQAINMF AHELQRMADA IEAGDEGKLR SLLEEAANIR RNRYYKDNTH                  290
//

If you have problems or comments...

PBIL Back to PBIL home page