(data stored in ACNUC7421 zone)

EMBL: CP001825.PE105

CP001825.PE105       Location/Qualifiers
FT   CDS             117416..118735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0107"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: 3-phosphoshikimate 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   bha:BH1667 3-phosphoshikimate 1- carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41029"
FT                   /db_xref="GOA:D1CDM3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM3"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ACZ41029.1"
FT                   /translation="MDITISPARSVHGNIMPPGDKSISHRAAIFGALAQGTTDIYNYSP
FT                   ARDCQSTLECLLSLGTGIRRDGNYIRVEGVGDTGFKEPESILDCGNSGTTMRLLIGALA
FT                   PMDLYAVLIGDKSLTKRPMDRVLKPLGDMGLRYYARNKDRYPPVSIRGGKIQGIHYQTP
FT                   VASAQVKSAILLAGLRAEGETVVTEPAKSRDHTERMLKAMGAQIQSDGTTVRLVASRLS
FT                   ATTFHVPADPSSAAFILAAALIVPESKVTTSNICLNPTRIGFLNVLERMGANIEIHNER
FT                   ESSGEPIGDIEASTSELNGIEIGGTEIPTLIDEIPILAVLATQAKGRTVIRDAEELRIK
FT                   ETDRISVLCRALQQMGADIREMRDGFEIHGPCKLKGAKVDPDHDHRIAMALAVASLIAE
FT                   DKTTILGAECASISYPNFWDHLSSLGVELSGTQSDSKTNV"
     MDITISPARS VHGNIMPPGD KSISHRAAIF GALAQGTTDI YNYSPARDCQ STLECLLSLG        60
     TGIRRDGNYI RVEGVGDTGF KEPESILDCG NSGTTMRLLI GALAPMDLYA VLIGDKSLTK       120
     RPMDRVLKPL GDMGLRYYAR NKDRYPPVSI RGGKIQGIHY QTPVASAQVK SAILLAGLRA       180
     EGETVVTEPA KSRDHTERML KAMGAQIQSD GTTVRLVASR LSATTFHVPA DPSSAAFILA       240
     AALIVPESKV TTSNICLNPT RIGFLNVLER MGANIEIHNE RESSGEPIGD IEASTSELNG       300
     IEIGGTEIPT LIDEIPILAV LATQAKGRTV IRDAEELRIK ETDRISVLCR ALQQMGADIR       360
     EMRDGFEIHG PCKLKGAKVD PDHDHRIAMA LAVASLIAED KTTILGAECA SISYPNFWDH       420
     LSSLGVELSG TQSDSKTNV                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page