(data stored in ACNUC7421 zone)

EMBL: CP001825.PE106

CP001825.PE106       Location/Qualifiers
FT   CDS             118745..119614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0108"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: pca:Pcar_2150 shikimate 5-dehydrogenase-like
FT                   oxidoreductase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41030"
FT                   /db_xref="GOA:D1CDM4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM4"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACZ41030.1"
FT                   /translation="MKQVGVIGYPIKHSISPVFQQAAFDALGIEAIYKAYEVPPEDLRS
FT                   FFFNLRNGNWLGVNVTIPHKSAAAKLADERSQEVSFTGAANTIISMNGRLKAHNTDISG
FT                   FILALEENGFQIKSKRAVVLGSGGTTRAVVYALAICEAQSIAVIGRSQDKVHSLISELK
FT                   PFFEHKQVTVTGHSWEKDSIRRQIQNSDILINTTPIGMKGTDQEHLSPVSKEDLSSDLI
FT                   VFDVVYNPIMTPLLTYAKDVGASTISGIEMLIYQGAESFRLWTGQEPPVDIMRKAAIKA
FT                   MEEKSRDV"
     MKQVGVIGYP IKHSISPVFQ QAAFDALGIE AIYKAYEVPP EDLRSFFFNL RNGNWLGVNV        60
     TIPHKSAAAK LADERSQEVS FTGAANTIIS MNGRLKAHNT DISGFILALE ENGFQIKSKR       120
     AVVLGSGGTT RAVVYALAIC EAQSIAVIGR SQDKVHSLIS ELKPFFEHKQ VTVTGHSWEK       180
     DSIRRQIQNS DILINTTPIG MKGTDQEHLS PVSKEDLSSD LIVFDVVYNP IMTPLLTYAK       240
     DVGASTISGI EMLIYQGAES FRLWTGQEPP VDIMRKAAIK AMEEKSRDV                   289
//

If you have problems or comments...

PBIL Back to PBIL home page