(data stored in ACNUC7421 zone)

EMBL: CP001825.PE107

CP001825.PE107       Location/Qualifiers
FT   CDS             119607..120761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0109"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="KEGG: sus:Acid_2745 chorismate synthase; TIGRFAM:
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41031"
FT                   /db_xref="GOA:D1CDM5"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM5"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ACZ41031.1"
FT                   /translation="MFRWLTAGESHGQALVALIDGMPAGFKINIDEINKELRRRQGGYG
FT                   RGGRQKIERDTAHVLSGIRNGTTLGSPISIMIRNLDWENWQNVMRVEPGEEPKKVTRLR
FT                   PGHADMAGSLKYGHDDVRNVLERASARETAARVAVGAIAKQCLQEFGISIHSLTRSIGP
FT                   IRSDATPPYDWQQIEESPVRAPSHSEEMVKAIDEARENGDTLGGIFEVIAEGVPVGLGS
FT                   HTQWDRKLDGRIAQAFMSIQAVKGVGIGAAWEAASLPGSQVHDVIIPDEEGNLKHATNR
FT                   AGGVEGGISNGEPIVVQAALKPISTLLKPLDSADLITREPMKARYERSDICVVPAAGVV
FT                   GEAMLAIVLWDAFLEKFGGDSLREIRRNYEGYIESLKLGNFAQS"
     MFRWLTAGES HGQALVALID GMPAGFKINI DEINKELRRR QGGYGRGGRQ KIERDTAHVL        60
     SGIRNGTTLG SPISIMIRNL DWENWQNVMR VEPGEEPKKV TRLRPGHADM AGSLKYGHDD       120
     VRNVLERASA RETAARVAVG AIAKQCLQEF GISIHSLTRS IGPIRSDATP PYDWQQIEES       180
     PVRAPSHSEE MVKAIDEARE NGDTLGGIFE VIAEGVPVGL GSHTQWDRKL DGRIAQAFMS       240
     IQAVKGVGIG AAWEAASLPG SQVHDVIIPD EEGNLKHATN RAGGVEGGIS NGEPIVVQAA       300
     LKPISTLLKP LDSADLITRE PMKARYERSD ICVVPAAGVV GEAMLAIVLW DAFLEKFGGD       360
     SLREIRRNYE GYIESLKLGN FAQS                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page