(data stored in ACNUC7421 zone)

EMBL: CP001825.PE109

CP001825.PE109       Location/Qualifiers
FT   CDS             121195..121530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0111"
FT                   /product="2',3'-cyclic nucleotide
FT                   2'-phosphodiesterase/3'-nucleotidase bifunctional
FT                   periplasmic precursor protein"
FT                   /note="KEGG: bca:BCE_4194 2',3'-cyclic nucleotide 2'-
FT                   phosphodiesterase/3'-nucleotidase bifunctional periplasmic
FT                   precursor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41033"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM7"
FT                   /inference="similar to AA sequence:KEGG:BCE_4194"
FT                   /protein_id="ACZ41033.1"
FT                   /translation="MENTNKQEDRKVTRLPDAEAEGAGNFGAEPDNDPTAGNTPNAISA
FT                   LSETAQLPEAENPQEPTPLAEEGNRTGGEPSEDIVARHADSERDEQAADQQMEERGLPK
FT                   DMTIEEE"
     MENTNKQEDR KVTRLPDAEA EGAGNFGAEP DNDPTAGNTP NAISALSETA QLPEAENPQE        60
     PTPLAEEGNR TGGEPSEDIV ARHADSERDE QAADQQMEER GLPKDMTIEE E                111
//

If you have problems or comments...

PBIL Back to PBIL home page