(data stored in ACNUC7421 zone)

EMBL: CP001825.PE11

CP001825.PE11        Location/Qualifiers
FT   CDS             11705..12451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0012"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bha:BH2491 3-oxoacyl-(acyl-carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40935"
FT                   /db_xref="GOA:D1CDC9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDC9"
FT                   /inference="protein motif:TFAM:TIGR01830"
FT                   /protein_id="ACZ40935.1"
FT                   /translation="MDLEGKVALVTGGSRGIGRATAIKLASLGARVVVNYNRSKEAAEE
FT                   VVRAISEAGGEAVASPGDVSTKEGAENAVNTALNTWGKIDILVNNAGITRDTLLMRMSE
FT                   EDWEAVIDTNLKGAYLCSKLAVRSMLRNRWGRIINISSVVGLVGNVGQANYASAKAGLL
FT                   GLTKSIAREFGSKNITANAIAPGYIETDIVAVLSEDIKKAILSQIPAGRYGKPEEVAEL
FT                   VAFLASDKAAYINGQTINIDGGMVMI"
     MDLEGKVALV TGGSRGIGRA TAIKLASLGA RVVVNYNRSK EAAEEVVRAI SEAGGEAVAS        60
     PGDVSTKEGA ENAVNTALNT WGKIDILVNN AGITRDTLLM RMSEEDWEAV IDTNLKGAYL       120
     CSKLAVRSML RNRWGRIINI SSVVGLVGNV GQANYASAKA GLLGLTKSIA REFGSKNITA       180
     NAIAPGYIET DIVAVLSEDI KKAILSQIPA GRYGKPEEVA ELVAFLASDK AAYINGQTIN       240
     IDGGMVMI                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page