(data stored in ACNUC7421 zone)

EMBL: CP001825.PE110

CP001825.PE110       Location/Qualifiers
FT   CDS             121535..121894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41034"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41034.1"
FT                   /translation="MPRNQWSKEREKEYQELKEEFEEEGRYKGREEEVAARIVNKQRRE
FT                   YGETKEAKAEDKEGSSPDRGLPIKNYDNLTVDEILSKSKGLSASVLKEIESYEKKHKNR
FT                   KTLLEQLDRMIGSKS"
     MPRNQWSKER EKEYQELKEE FEEEGRYKGR EEEVAARIVN KQRREYGETK EAKAEDKEGS        60
     SPDRGLPIKN YDNLTVDEIL SKSKGLSASV LKEIESYEKK HKNRKTLLEQ LDRMIGSKS        119
//

If you have problems or comments...

PBIL Back to PBIL home page