(data stored in ACNUC7421 zone)

EMBL: CP001825.PE113

CP001825.PE113       Location/Qualifiers
FT   CDS             124030..124833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0115"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: lpf:lpl0291
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41037"
FT                   /db_xref="GOA:D1CDN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACZ41037.1"
FT                   /translation="MPFASNGDLKIYYEEVGKGDPVVWIQGLGASNTAWNVQKFHFSQR
FT                   FRCIFIDNRDVGQSSRANADYTTKDMAEDVLCVLESANVDSAHIIGLSMGGAIAQELAL
FT                   NSPKKVKSLVLVSTFATPDARIRAVNAAWGELYGKVNRELFYKQVEPWLFSPSYLEKPS
FT                   NIRAFRRYIQHEPNPQETDAYQRQVRAVLSHNTADRLEKISNPTLIIAGEQDILVSPLH
FT                   SKLLAELIPNAELEIIPGAAHSVNLENQKEFNNRVRSFLESYLET"
     MPFASNGDLK IYYEEVGKGD PVVWIQGLGA SNTAWNVQKF HFSQRFRCIF IDNRDVGQSS        60
     RANADYTTKD MAEDVLCVLE SANVDSAHII GLSMGGAIAQ ELALNSPKKV KSLVLVSTFA       120
     TPDARIRAVN AAWGELYGKV NRELFYKQVE PWLFSPSYLE KPSNIRAFRR YIQHEPNPQE       180
     TDAYQRQVRA VLSHNTADRL EKISNPTLII AGEQDILVSP LHSKLLAELI PNAELEIIPG       240
     AAHSVNLENQ KEFNNRVRSF LESYLET                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page