(data stored in ACNUC7421 zone)

EMBL: CP001825.PE115

CP001825.PE115       Location/Qualifiers
FT   CDS             complement(126345..129320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0117"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; KEGG: tbd:Tbd_2206 translocation protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41039"
FT                   /db_xref="GOA:D1CDN3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41039.1"
FT                   /translation="MSDDSHASLTVADFTLADHLGLEALQVLVNPILPQLYDFIARRTI
FT                   DGQEAEDVLQQTLWLAFKTCYKSDQELGLLDWLLSIATRVLLNRVNSDPLCECGLGFLV
FT                   QDDSGRTNDKVSRLYGRLLASEISHFAKTQRFILGLFVHERWSIHRISTVLGISPHKVE
FT                   SSISTTVLQILIDLWPEEPESRLNRNDVYLITREILLGNISGSYPRIRSLIDTLSVKHT
FT                   TFSMPPNLEARLWKSCSADFPQQYVPPLAVGNDNIRVYLWAVAACIVLLFAAVLGANFF
FT                   GIDSSAKPSQVKTAERLVSDQNVSNRSDDSTSNIAARINGFVRDRYLSGRLVLLHYGPD
FT                   GNSVGVVDFDTGNIARDVFTDLSPNVVFAISPSGRYLAYGKQDAVMLSDIIDRSPPRWL
FT                   ITLQSPNTDRWRYEMDRTPHRFRVAALAWHPNEQILAVASEPIYYRGLEHSRVQLVRVR
FT                   NSGGETISTIVTLQSFEDVVSLDWSADGTQLLIGTDRRILLASFSRFGFWDLKQLPGRG
FT                   TATWSPDDKLVLWVSPSDSASGSSLFGVTNPSTGKSSTLGTCDYARWEDDPNYVVFLQG
FT                   VSNHSDRIVLSRMNLSSGEVDQVLQVAFKGNFESNALLSPDGRYLLYNDEDGLHLYDAK
FT                   FQESVWRLDYPPKEVISPLVWMSGWQSYDREFETLSGTIIYPKKSGSKVSLVSLDLRTG
FT                   STRQIAAASKLSYTVGDQALMVRTSKSNALLYTQEGIIKLYIPPKMQDITAVELTSSGS
FT                   TIAYATREGRGVAIWEITPQRSRVNLARSKPIAHLRTIPLSLDFSPSGRWILIKDRNNV
FT                   WHLFNNKFKRIKILPRADRYSWMVLDGKDVLVQLKNLNISIYTPRGKTVYEINGYVNAY
FT                   APLDDGYIAVWTMDDDLRVYDLRKKDFVTWGSMLGMDYSELDDSSLVQIVPISDGGSWI
FT                   ALRLRDSVYMLDLSNGYQYPLQIKATSAGELTWLSGDPNPQFRRYVDWDSCHEVPPDKC
FT                   PA"
     MSDDSHASLT VADFTLADHL GLEALQVLVN PILPQLYDFI ARRTIDGQEA EDVLQQTLWL        60
     AFKTCYKSDQ ELGLLDWLLS IATRVLLNRV NSDPLCECGL GFLVQDDSGR TNDKVSRLYG       120
     RLLASEISHF AKTQRFILGL FVHERWSIHR ISTVLGISPH KVESSISTTV LQILIDLWPE       180
     EPESRLNRND VYLITREILL GNISGSYPRI RSLIDTLSVK HTTFSMPPNL EARLWKSCSA       240
     DFPQQYVPPL AVGNDNIRVY LWAVAACIVL LFAAVLGANF FGIDSSAKPS QVKTAERLVS       300
     DQNVSNRSDD STSNIAARIN GFVRDRYLSG RLVLLHYGPD GNSVGVVDFD TGNIARDVFT       360
     DLSPNVVFAI SPSGRYLAYG KQDAVMLSDI IDRSPPRWLI TLQSPNTDRW RYEMDRTPHR       420
     FRVAALAWHP NEQILAVASE PIYYRGLEHS RVQLVRVRNS GGETISTIVT LQSFEDVVSL       480
     DWSADGTQLL IGTDRRILLA SFSRFGFWDL KQLPGRGTAT WSPDDKLVLW VSPSDSASGS       540
     SLFGVTNPST GKSSTLGTCD YARWEDDPNY VVFLQGVSNH SDRIVLSRMN LSSGEVDQVL       600
     QVAFKGNFES NALLSPDGRY LLYNDEDGLH LYDAKFQESV WRLDYPPKEV ISPLVWMSGW       660
     QSYDREFETL SGTIIYPKKS GSKVSLVSLD LRTGSTRQIA AASKLSYTVG DQALMVRTSK       720
     SNALLYTQEG IIKLYIPPKM QDITAVELTS SGSTIAYATR EGRGVAIWEI TPQRSRVNLA       780
     RSKPIAHLRT IPLSLDFSPS GRWILIKDRN NVWHLFNNKF KRIKILPRAD RYSWMVLDGK       840
     DVLVQLKNLN ISIYTPRGKT VYEINGYVNA YAPLDDGYIA VWTMDDDLRV YDLRKKDFVT       900
     WGSMLGMDYS ELDDSSLVQI VPISDGGSWI ALRLRDSVYM LDLSNGYQYP LQIKATSAGE       960
     LTWLSGDPNP QFRRYVDWDS CHEVPPDKCP A                                      991
//

If you have problems or comments...

PBIL Back to PBIL home page