(data stored in ACNUC7421 zone)

EMBL: CP001825.PE116

CP001825.PE116       Location/Qualifiers
FT   CDS             complement(129404..130315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0118"
FT                   /product="homoserine kinase"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: predicted protein; K00872
FT                   homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41040"
FT                   /db_xref="GOA:D1CDN4"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDN4"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ACZ41040.1"
FT                   /translation="MRIHVRVPAASGNLGSGFDCAGMALALYNEAILDTDAKGVVIEGE
FT                   GADFLPREESNACLKAMMELASRLDCQLPSFGLRLINRIPIGRGLASSGAAALAGLLLA
FT                   NELLGCPKDREQIMELATELEGHPDNVAAALLGGITISAWDGSKVHTVRIDPDPSMKAV
FT                   LWVPDSQVYTKHARSILPKQVSMQDAVFNLSRAALMAASFARGEYNLLQVATQDRLHQP
FT                   YRASLVKGLQESMLSALEAGALATWISGAGPSVLALCIDNVQAVELALWHIASKYNDGK
FT                   VMTLEIDTCGAQVTKMAEEVEV"
     MRIHVRVPAA SGNLGSGFDC AGMALALYNE AILDTDAKGV VIEGEGADFL PREESNACLK        60
     AMMELASRLD CQLPSFGLRL INRIPIGRGL ASSGAAALAG LLLANELLGC PKDREQIMEL       120
     ATELEGHPDN VAAALLGGIT ISAWDGSKVH TVRIDPDPSM KAVLWVPDSQ VYTKHARSIL       180
     PKQVSMQDAV FNLSRAALMA ASFARGEYNL LQVATQDRLH QPYRASLVKG LQESMLSALE       240
     AGALATWISG AGPSVLALCI DNVQAVELAL WHIASKYNDG KVMTLEIDTC GAQVTKMAEE       300
     VEV                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page