(data stored in ACNUC7421 zone)

EMBL: CP001825.PE12

CP001825.PE12        Location/Qualifiers
FT   CDS             12514..13434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0013"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: gur:Gura_1876
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40936"
FT                   /db_xref="GOA:D1CDD0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD0"
FT                   /inference="protein motif:TFAM:TIGR00128"
FT                   /protein_id="ACZ40936.1"
FT                   /translation="MSSRRIALVFPGQGSQYVGMGKALHDASEAAREVFKRADEILGFR
FT                   LSHLCFSGPEEDLQDTINAQPAIFTVSLATLAAIKEKLHEAGVKLNPSFVAGHSLGEYT
FT                   ALVAANVIDFEDGLRLVRERGRLMKEEGEKIPGGMAAVIGLDEEVIQRACEEASSEGIV
FT                   GIANSNSPGQIVISGELKALHRAMELLQQQGAKKVIKLPISIASHSPVMQRAAAQFAEI
FT                   VSHMKLRDPQIPIVANVTGQILTNVEDIRRELSHHITGPVQWTKSIREMLSHGTNGFIE
FT                   LGPKRVLTGLIQRISPGVDTISTDS"
     MSSRRIALVF PGQGSQYVGM GKALHDASEA AREVFKRADE ILGFRLSHLC FSGPEEDLQD        60
     TINAQPAIFT VSLATLAAIK EKLHEAGVKL NPSFVAGHSL GEYTALVAAN VIDFEDGLRL       120
     VRERGRLMKE EGEKIPGGMA AVIGLDEEVI QRACEEASSE GIVGIANSNS PGQIVISGEL       180
     KALHRAMELL QQQGAKKVIK LPISIASHSP VMQRAAAQFA EIVSHMKLRD PQIPIVANVT       240
     GQILTNVEDI RRELSHHITG PVQWTKSIRE MLSHGTNGFI ELGPKRVLTG LIQRISPGVD       300
     TISTDS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page