(data stored in ACNUC7421 zone)

EMBL: CP001825.PE122

CP001825.PE122       Location/Qualifiers
FT   CDS             complement(135224..136057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0124"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SM_b20969 putative
FT                   sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41046"
FT                   /db_xref="GOA:D1CDP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41046.1"
FT                   /translation="MVGRILHSTSVYIMLIALSLFILMPIGWMLTAALKPSTAPVFTYP
FT                   PEWFPTKYWEWKTFRDALFEENFFIYTRNTVILVLLNVVGALFSCSMIAYAFARLKFRG
FT                   KNLLFTILVATMLLPGPVLLIPQFLLFYRIGWYNTYFPLFVPAFTGNAFFIFLLRQYMK
FT                   TLPIELDEAARIDGASYWGIYWRIILPLSIPALTVVAVFQFLATWNDFFGPLIYLDDPD
FT                   KFTLALGLATMVRRVGTEWNEVMAANLVAVIPVLIVYFLAQNKLIGGIASVGLKG"
     MVGRILHSTS VYIMLIALSL FILMPIGWML TAALKPSTAP VFTYPPEWFP TKYWEWKTFR        60
     DALFEENFFI YTRNTVILVL LNVVGALFSC SMIAYAFARL KFRGKNLLFT ILVATMLLPG       120
     PVLLIPQFLL FYRIGWYNTY FPLFVPAFTG NAFFIFLLRQ YMKTLPIELD EAARIDGASY       180
     WGIYWRIILP LSIPALTVVA VFQFLATWND FFGPLIYLDD PDKFTLALGL ATMVRRVGTE       240
     WNEVMAANLV AVIPVLIVYF LAQNKLIGGI ASVGLKG                                277
//

If you have problems or comments...

PBIL Back to PBIL home page