(data stored in ACNUC7421 zone)

EMBL: CP001825.PE123

CP001825.PE123       Location/Qualifiers
FT   CDS             complement(136099..137007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0125"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: togM; ABC transporter
FT                   membrane spanning protein (galacturonic acid); K02025
FT                   multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41047"
FT                   /db_xref="GOA:D1CDP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41047.1"
FT                   /translation="MSKHSPLSAREEKAAYLFLTPWFIGLIFFLAVPLVWSLYISMTDK
FT                   RLISAGGEHFIGLQNYMYMFTQDGYFYHSLYVTLKWLVLTTPLYLLAGLFISLLLNQKL
FT                   PGIHLFRTILYIPAVLSGVAVAVLWLQLFNPELGAINYLLYRIGIDNPPYWLQDPRWAM
FT                   PAVIIMGLWGVGGTAIIYLAGLQNIPPHLYEAASIDGAGSIAKFFYITLPMLSPTIFFL
FT                   LVNAIIDSLLIFGPVFVLGGDGGPEDSLLFYMLYLYRRAFIQGLMGYATALAWVLTILG
FT                   VILVFLMFRFERRFVFYEAAE"
     MSKHSPLSAR EEKAAYLFLT PWFIGLIFFL AVPLVWSLYI SMTDKRLISA GGEHFIGLQN        60
     YMYMFTQDGY FYHSLYVTLK WLVLTTPLYL LAGLFISLLL NQKLPGIHLF RTILYIPAVL       120
     SGVAVAVLWL QLFNPELGAI NYLLYRIGID NPPYWLQDPR WAMPAVIIMG LWGVGGTAII       180
     YLAGLQNIPP HLYEAASIDG AGSIAKFFYI TLPMLSPTIF FLLVNAIIDS LLIFGPVFVL       240
     GGDGGPEDSL LFYMLYLYRR AFIQGLMGYA TALAWVLTIL GVILVFLMFR FERRFVFYEA       300
     AE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page