(data stored in ACNUC7421 zone)

EMBL: CP001825.PE125

CP001825.PE125       Location/Qualifiers
FT   CDS             138635..139672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0127"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sus:Acid_2859 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41049"
FT                   /db_xref="GOA:D1CDP3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP3"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACZ41049.1"
FT                   /translation="MRGVVLPGNRTVDLREFPTPQPGYGQVLVRMKASGICGSDIRAIY
FT                   REWLGTGPEAYKGCIAGHEPCGIVEEVGPGVEHFSPGDRVVVYHIVGCGVCKDCRAGWM
FT                   INCKAPYPYRAAYGWQRDGGHADFLLAEQRTLIKLPDNLTFVDGALAACGLGTGYQAIL
FT                   RAGVSGRDRVAVVGLGPVGLGILMLARASGAEVIGIDVIPERLEMAQKIGAEHTFLSGD
FT                   NTAERIMDLTKGEGVEVVIDASGNPLGRHLCLEIAGEWGRVVFVGEGNTVSFEPSPLLI
FT                   HKQLTLMGSWVCGLVQMEELLGFLSRKELHPEQIVTHKFPLEDADEAYRLFDSGKSGKV
FT                   VITWD"
     MRGVVLPGNR TVDLREFPTP QPGYGQVLVR MKASGICGSD IRAIYREWLG TGPEAYKGCI        60
     AGHEPCGIVE EVGPGVEHFS PGDRVVVYHI VGCGVCKDCR AGWMINCKAP YPYRAAYGWQ       120
     RDGGHADFLL AEQRTLIKLP DNLTFVDGAL AACGLGTGYQ AILRAGVSGR DRVAVVGLGP       180
     VGLGILMLAR ASGAEVIGID VIPERLEMAQ KIGAEHTFLS GDNTAERIMD LTKGEGVEVV       240
     IDASGNPLGR HLCLEIAGEW GRVVFVGEGN TVSFEPSPLL IHKQLTLMGS WVCGLVQMEE       300
     LLGFLSRKEL HPEQIVTHKF PLEDADEAYR LFDSGKSGKV VITWD                       345
//

If you have problems or comments...

PBIL Back to PBIL home page