(data stored in ACNUC7421 zone)

EMBL: CP001825.PE128

CP001825.PE128       Location/Qualifiers
FT   CDS             141554..142675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU06570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41052"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP6"
FT                   /inference="similar to AA sequence:KEGG:BSU06570"
FT                   /protein_id="ACZ41052.1"
FT                   /translation="MMKTHNLIYTTLVLLLIAFITACGSGSSANENSPTPTTPESSTLQ
FT                   SPSPEPTPTQVASTPPTQMPSPQPTSTPEHKEKRTDKNLLSPRKRPIAIMVENHPDARP
FT                   QSGLINADVIYEAPAEFGIPRFMAIFVNKESKIVGPIRSARTYYVSWASEYNPVYVHAG
FT                   GSPQGIRLIDQLGLQHIDALRYYAPQAFWRSTDRDAPHNLYGSTTEIRKLIAKDKNLQG
FT                   KKGTWGPIHWSNNPTIGSESGKEVSVTYAEGYQASFKYDPQTGLYNRYMVGKPHLDRET
FT                   KRQIAASAVIVQTVDMWQIKGDAYGRREVDLTNASGPILVFQNGKVLKGKWEKEDVDTI
FT                   TKYETNDGKPIELKPGQVWIEIVPKEGSKIDYR"
     MMKTHNLIYT TLVLLLIAFI TACGSGSSAN ENSPTPTTPE SSTLQSPSPE PTPTQVASTP        60
     PTQMPSPQPT STPEHKEKRT DKNLLSPRKR PIAIMVENHP DARPQSGLIN ADVIYEAPAE       120
     FGIPRFMAIF VNKESKIVGP IRSARTYYVS WASEYNPVYV HAGGSPQGIR LIDQLGLQHI       180
     DALRYYAPQA FWRSTDRDAP HNLYGSTTEI RKLIAKDKNL QGKKGTWGPI HWSNNPTIGS       240
     ESGKEVSVTY AEGYQASFKY DPQTGLYNRY MVGKPHLDRE TKRQIAASAV IVQTVDMWQI       300
     KGDAYGRREV DLTNASGPIL VFQNGKVLKG KWEKEDVDTI TKYETNDGKP IELKPGQVWI       360
     EIVPKEGSKI DYR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page