(data stored in ACNUC7421 zone)

EMBL: CP001825.PE129

CP001825.PE129       Location/Qualifiers
FT   CDS             complement(142760..143176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0131"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   scl:sce2941 molybdopterin-converting factor chain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41053"
FT                   /db_xref="GOA:D1CDP7"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP7"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ACZ41053.1"
FT                   /translation="MIAVTQDPISIDELISSVSHPGAGAIVIFLGVVRDNNEGRKVRYL
FT                   EYESYEPAAKASMQKICGFAKDKWPGVRISAVHRVGKLNIGDISVAVVASAPHRQEAFA
FT                   AARFVIDSIKEESPIWKKEIFEGGEVWIGDPSPS"
     MIAVTQDPIS IDELISSVSH PGAGAIVIFL GVVRDNNEGR KVRYLEYESY EPAAKASMQK        60
     ICGFAKDKWP GVRISAVHRV GKLNIGDISV AVVASAPHRQ EAFAAARFVI DSIKEESPIW       120
     KKEIFEGGEV WIGDPSPS                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page