(data stored in ACNUC7421 zone)

EMBL: CP001825.PE130

CP001825.PE130       Location/Qualifiers
FT   CDS             complement(143142..143444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0132"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: CNX7/SIR5; CNX7/SIR5;
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41054"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDP8"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACZ41054.1"
FT                   /translation="MNIAGGSFEIKLLLFAQFREVIGQKELLYKVTIGSTPASVLRSLI
FT                   GEYPDLARLESVTKFIVNEEFVPGDYKLSPGDTLAFIPPVAGGRDDSSDSRSHIH"
     MNIAGGSFEI KLLLFAQFRE VIGQKELLYK VTIGSTPASV LRSLIGEYPD LARLESVTKF        60
     IVNEEFVPGD YKLSPGDTLA FIPPVAGGRD DSSDSRSHIH                             100
//

If you have problems or comments...

PBIL Back to PBIL home page