(data stored in ACNUC7421 zone)

EMBL: CP001825.PE132

CP001825.PE132       Location/Qualifiers
FT   CDS             144937..145479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41056"
FT                   /db_xref="GOA:D1CDQ0"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41056.1"
FT                   /translation="MYNIIKNFIFILIGIVLGAIITLVFIVTRPQPEITPSASNSGQSP
FT                   DMRLSISQEIFVQQANSEAKDILSKYGLSNPKWYLQPDNQVTMDAQTRIPIIDLPVQVR
FT                   IRGSLYTNSGRVHATIESVDYGGLRLPVELFDNLSRELNRELESSQDTSKYWIESVDTN
FT                   QGRLNLDIDLRGNWLSR"
     MYNIIKNFIF ILIGIVLGAI ITLVFIVTRP QPEITPSASN SGQSPDMRLS ISQEIFVQQA        60
     NSEAKDILSK YGLSNPKWYL QPDNQVTMDA QTRIPIIDLP VQVRIRGSLY TNSGRVHATI       120
     ESVDYGGLRL PVELFDNLSR ELNRELESSQ DTSKYWIESV DTNQGRLNLD IDLRGNWLSR       180
//

If you have problems or comments...

PBIL Back to PBIL home page