(data stored in ACNUC7421 zone)

EMBL: CP001825.PE135

CP001825.PE135       Location/Qualifiers
FT   CDS             147834..149153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0137"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   pla:Plav_1937 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41059"
FT                   /db_xref="GOA:D1CDQ3"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDQ3"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ACZ41059.1"
FT                   /translation="MPKITFIGAGSTVFAKNLIGDILSFPELQDSTICLFDIDPDRLST
FT                   SEIVANKIKQALNAPAKIEATTDRRKALYGADYALCMIQVAGYKPGTVIDFEIPKKYGL
FT                   RQTIADTLGIGGIMRALRTIPVLLDMCKDMEELCPDVYFLNYVNPMAMNCWAISRASKI
FT                   KTVGLCHSVQGTAWELSKDIGVPLEEINFVCAGINHMAFYLKFERNGEDLYPLIRKVIE
FT                   EGRVPEHNRVRYDVFKRFGYFVTESSEHFSEYVPWYIKRDRPDLIEKYNIPLDEYIRRC
FT                   EAQIAGWEELRKRYESDEPIQVERTHEFASYIIHSIETGIPKLDEKGNTRVIYGNVPNN
FT                   GLIDNLPQGCCVEVPCLVDRNGIQPIKIGSLPIQLAALMQTNINVQALTVEAALTRKKE
FT                   YIYQAAMLDPHTAAELDPDQIYSLVDELIAAHGDWLPEYH"
     MPKITFIGAG STVFAKNLIG DILSFPELQD STICLFDIDP DRLSTSEIVA NKIKQALNAP        60
     AKIEATTDRR KALYGADYAL CMIQVAGYKP GTVIDFEIPK KYGLRQTIAD TLGIGGIMRA       120
     LRTIPVLLDM CKDMEELCPD VYFLNYVNPM AMNCWAISRA SKIKTVGLCH SVQGTAWELS       180
     KDIGVPLEEI NFVCAGINHM AFYLKFERNG EDLYPLIRKV IEEGRVPEHN RVRYDVFKRF       240
     GYFVTESSEH FSEYVPWYIK RDRPDLIEKY NIPLDEYIRR CEAQIAGWEE LRKRYESDEP       300
     IQVERTHEFA SYIIHSIETG IPKLDEKGNT RVIYGNVPNN GLIDNLPQGC CVEVPCLVDR       360
     NGIQPIKIGS LPIQLAALMQ TNINVQALTV EAALTRKKEY IYQAAMLDPH TAAELDPDQI       420
     YSLVDELIAA HGDWLPEYH                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page