(data stored in ACNUC7421 zone)

EMBL: CP001825.PE142

CP001825.PE142       Location/Qualifiers
FT   CDS             154317..154913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0144"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: hpp:HPP12_0857
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41066"
FT                   /db_xref="GOA:D1CDR0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR0"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACZ41066.1"
FT                   /translation="MTISINNLLQKRQEKLNVAINQLIRDSELLESVANTLIQSLCSNK
FT                   KILICGNGGSAAQAQHMAGELIGRFKKNRAPIAALALGTDMATTTAIANDFGYEEVFLR
FT                   QVDALGNDGDVLLILSTSGNSPNVLAAVNTARRKGLKTVAFTGKKPSKVEDLADIVVRF
FT                   PAEETDVIQELHLLAIHILCEVVEEHLSKEVVDGQ"
     MTISINNLLQ KRQEKLNVAI NQLIRDSELL ESVANTLIQS LCSNKKILIC GNGGSAAQAQ        60
     HMAGELIGRF KKNRAPIAAL ALGTDMATTT AIANDFGYEE VFLRQVDALG NDGDVLLILS       120
     TSGNSPNVLA AVNTARRKGL KTVAFTGKKP SKVEDLADIV VRFPAEETDV IQELHLLAIH       180
     ILCEVVEEHL SKEVVDGQ                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page