(data stored in ACNUC7421 zone)

EMBL: CP001825.PE143

CP001825.PE143       Location/Qualifiers
FT   CDS             154903..155517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0145"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="TIGRFAM: D,D-heptose 1,7-bisphosphate phosphatase;
FT                   histidinol-phosphate phosphatase family protein; hydrolase,
FT                   HAD-superfamily, subfamily IIIA; PFAM: Polynucleotide
FT                   kinase 3 phosphatase central region; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: D,D-heptose
FT                   1,7-bisphosphate phosphatase; K03273
FT                   D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41067"
FT                   /db_xref="GOA:D1CDR1"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR1"
FT                   /inference="protein motif:TFAM:TIGR00213"
FT                   /protein_id="ACZ41067.1"
FT                   /translation="MGNKAVFLDRDGTLVHPRHYPSRAEDLVLYRGLPEEMRILQQMGF
FT                   KLVVITNQGGIAHGYFTERDLELMHTSLQDQLSEFGVRIDAFYYCPHHPEGNLAHLACE
FT                   CECRKPKPGMILQAAKDMNLDLSSSWMVGDILNDVEAGRKAGCKTILVDLGTESKPSSP
FT                   DRTPDYVARTTKHALQIIQSLEGQRKDVDLDYIPSSWKAAV"
     MGNKAVFLDR DGTLVHPRHY PSRAEDLVLY RGLPEEMRIL QQMGFKLVVI TNQGGIAHGY        60
     FTERDLELMH TSLQDQLSEF GVRIDAFYYC PHHPEGNLAH LACECECRKP KPGMILQAAK       120
     DMNLDLSSSW MVGDILNDVE AGRKAGCKTI LVDLGTESKP SSPDRTPDYV ARTTKHALQI       180
     IQSLEGQRKD VDLDYIPSSW KAAV                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page