(data stored in ACNUC7421 zone)

EMBL: CP001825.PE144

CP001825.PE144       Location/Qualifiers
FT   CDS             155545..157032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0146"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   PFAM: PfkB domain protein; cytidylyltransferase; KEGG:
FT                   nmu:Nmul_A1792 bifunctional ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41068"
FT                   /db_xref="GOA:D1CDR2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR2"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACZ41068.1"
FT                   /translation="MLKVDIVNNFHKVRALVIGDAMLDSYLEGTASRLCSEGPVPVVTK
FT                   SGEERVPGGAANTASNLRALGAQVMFLGFVGRDANAAYLRTALRRYDIDDGWLVEDPNI
FT                   STIHKMRILADEQYVVRFDEGDTTNYSKSSREELLYKLEQALTKCDVIVVSDYSYGAVS
FT                   EDVTSVIKDFRRTQDIPLLVDSKNIISYGKASATLITPNHHEARAAVGRPASIKPPDIE
FT                   EMMGIGKQLLDCMDCQFIAITMASEGVLLLGQKAEPLHIPAYPIPKASVAGAGDSFLAA
FT                   TALSLAVGADIAEATRIGVENARLAVLKRRTAVVEHRELLLRMSTLDRQSDQPYESLIA
FT                   ELEAARREGKVIVMVNGVFDLLHAGHVNLLRKAKELGDLLVVAINSDKSARRLKGPNRP
FT                   INDERHRLELVASLEPVDHVVLFDEDTPIQLIKTIRPHVLVKGADYEGQEIPEAPILQD
FT                   IGTKLVLVPLTENYSTSSLIERILSSAPNQQLTSEVM"
     MLKVDIVNNF HKVRALVIGD AMLDSYLEGT ASRLCSEGPV PVVTKSGEER VPGGAANTAS        60
     NLRALGAQVM FLGFVGRDAN AAYLRTALRR YDIDDGWLVE DPNISTIHKM RILADEQYVV       120
     RFDEGDTTNY SKSSREELLY KLEQALTKCD VIVVSDYSYG AVSEDVTSVI KDFRRTQDIP       180
     LLVDSKNIIS YGKASATLIT PNHHEARAAV GRPASIKPPD IEEMMGIGKQ LLDCMDCQFI       240
     AITMASEGVL LLGQKAEPLH IPAYPIPKAS VAGAGDSFLA ATALSLAVGA DIAEATRIGV       300
     ENARLAVLKR RTAVVEHREL LLRMSTLDRQ SDQPYESLIA ELEAARREGK VIVMVNGVFD       360
     LLHAGHVNLL RKAKELGDLL VVAINSDKSA RRLKGPNRPI NDERHRLELV ASLEPVDHVV       420
     LFDEDTPIQL IKTIRPHVLV KGADYEGQEI PEAPILQDIG TKLVLVPLTE NYSTSSLIER       480
     ILSSAPNQQL TSEVM                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page