(data stored in ACNUC7421 zone)

EMBL: CP001825.PE146

CP001825.PE146       Location/Qualifiers
FT   CDS             158117..159163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0148"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   eba:ebA6912 ADP-heptose--LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41070"
FT                   /db_xref="GOA:D1CDR4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR4"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACZ41070.1"
FT                   /translation="MSKWLNVKNLLAVRLDNIGDVVMTGPALRAIKENLPETKITMLLS
FT                   PGGASAAPLLPWIDEVIAWKSLWQDLGDLPFDPARELELVEKLREHAFDGAIIFTSFSQ
FT                   DPHVPGYVCYLAGIPLRAGESKEFGGSVLTHELKSVPDNVHQVERNLRLIESLGFKVRD
FT                   RSLKIFIDEEASLSAHEKLGSMGIRVDEGYVVIHPGASASARRYPVDRFAVIAQELTRK
FT                   GIHVVVTGSDRERLLVEEIANAAPEVKTLVGVTSLSEYAAVLKMAKAVICNNTLPMHLS
FT                   DALRVPVVVLFSGTDEESAWGPRDTRALLMRKPTPCHPCYLFKCPIGQPCLDIPAHEVS
FT                   KAVLRIIS"
     MSKWLNVKNL LAVRLDNIGD VVMTGPALRA IKENLPETKI TMLLSPGGAS AAPLLPWIDE        60
     VIAWKSLWQD LGDLPFDPAR ELELVEKLRE HAFDGAIIFT SFSQDPHVPG YVCYLAGIPL       120
     RAGESKEFGG SVLTHELKSV PDNVHQVERN LRLIESLGFK VRDRSLKIFI DEEASLSAHE       180
     KLGSMGIRVD EGYVVIHPGA SASARRYPVD RFAVIAQELT RKGIHVVVTG SDRERLLVEE       240
     IANAAPEVKT LVGVTSLSEY AAVLKMAKAV ICNNTLPMHL SDALRVPVVV LFSGTDEESA       300
     WGPRDTRALL MRKPTPCHPC YLFKCPIGQP CLDIPAHEVS KAVLRIIS                    348
//

If you have problems or comments...

PBIL Back to PBIL home page