(data stored in ACNUC7421 zone)

EMBL: CP001825.PE147

CP001825.PE147       Location/Qualifiers
FT   CDS             159182..160240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0149"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bam:Bamb_5648 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41071"
FT                   /db_xref="GOA:D1CDR5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR5"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACZ41071.1"
FT                   /translation="MNHPVALDNIEKIAIFRALFLGDLFFTLPAFRALRERFPNAEITL
FT                   IGLPWAKEFVSRFRHYLDRFLEFPGYPGIIEVDVNPTRTQEFLIQARDYGYDLAIQMQG
FT                   NGTTSNGFVAELGARISLGHAVNGDDRLTISIPFTERPIKNEILRWLDLVSLLGAHSTP
FT                   DLEFPIYPHERARAEELIRPALYNNGPIVGMHMGAKEDIRRWPAQRFGELAKILVKLFD
FT                   ATIVLTGTSQEIGLSKEVEAAVGSNVVNLIGKTDLGTFAAVVSSMDLLVTNDTGASHIA
FT                   AATSTPSVVLFGPTTPEQFGPINQDLHKAVKAYEHVQSYSGSPLWELPVEPVLDACIYM
FT                   LQNYYVKPSTAF"
     MNHPVALDNI EKIAIFRALF LGDLFFTLPA FRALRERFPN AEITLIGLPW AKEFVSRFRH        60
     YLDRFLEFPG YPGIIEVDVN PTRTQEFLIQ ARDYGYDLAI QMQGNGTTSN GFVAELGARI       120
     SLGHAVNGDD RLTISIPFTE RPIKNEILRW LDLVSLLGAH STPDLEFPIY PHERARAEEL       180
     IRPALYNNGP IVGMHMGAKE DIRRWPAQRF GELAKILVKL FDATIVLTGT SQEIGLSKEV       240
     EAAVGSNVVN LIGKTDLGTF AAVVSSMDLL VTNDTGASHI AAATSTPSVV LFGPTTPEQF       300
     GPINQDLHKA VKAYEHVQSY SGSPLWELPV EPVLDACIYM LQNYYVKPST AF               352
//

If you have problems or comments...

PBIL Back to PBIL home page