(data stored in ACNUC7421 zone)

EMBL: CP001825.PE148

CP001825.PE148       Location/Qualifiers
FT   CDS             160254..161198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0150"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tbd:Tbd_0743 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41072"
FT                   /db_xref="GOA:D1CDR6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDR6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACZ41072.1"
FT                   /translation="MRRYKILCWHIHGSYLDALAQIDQDWYLPVTPDRGEGYGGRRPGM
FT                   PPYVREVPAEEVRNLDLDIIICQTPKNFYEDIPAILSPEQQKLPKIYLEHNCPRQHPTD
FT                   TKHPIDDPNVLLVHVTHFNNLMWDSGRTPTMVIEHSVAIDPSIEYVGDRDKGITVINEM
FT                   KRRGRISGYDIFCKARESVPLDTCGIKSEEIGGLGDIKYRDLHRLMARYRFLFSPMRYT
FT                   SLPLAVIEAMTIGMPVIALATTELPTMIQNDYNGYVSCDVEFLIDRMLFLLNNPKEAKR
FT                   LGQNAKCTAQERFNLDRFRRDWNKAFDLVAGGL"
     MRRYKILCWH IHGSYLDALA QIDQDWYLPV TPDRGEGYGG RRPGMPPYVR EVPAEEVRNL        60
     DLDIIICQTP KNFYEDIPAI LSPEQQKLPK IYLEHNCPRQ HPTDTKHPID DPNVLLVHVT       120
     HFNNLMWDSG RTPTMVIEHS VAIDPSIEYV GDRDKGITVI NEMKRRGRIS GYDIFCKARE       180
     SVPLDTCGIK SEEIGGLGDI KYRDLHRLMA RYRFLFSPMR YTSLPLAVIE AMTIGMPVIA       240
     LATTELPTMI QNDYNGYVSC DVEFLIDRML FLLNNPKEAK RLGQNAKCTA QERFNLDRFR       300
     RDWNKAFDLV AGGL                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page