(data stored in ACNUC7421 zone)

EMBL: CP001825.PE152

CP001825.PE152       Location/Qualifiers
FT   CDS             164302..164919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0154"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sus:Acid_2237
FT                   sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41076"
FT                   /db_xref="GOA:D1CDS0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS0"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACZ41076.1"
FT                   /translation="MIDTIKDYWNGITGSIRKVDLKAIEAAAWEIISCHNSGNNIYIVG
FT                   NGGSAATASHFACDLSKGARVPGQTPFRVLSLTDNMSLVTAWANDSSFEHVFAEQLRPM
FT                   IRQGDLLIVISASGNSPNVVFAAQVARDLGARVLGLTGKDGGKLRNIANLTITVPTEHI
FT                   EQVEDAHLVMAHCICFSIREYLTNKTIKIEDSALQQVFQANI"
     MIDTIKDYWN GITGSIRKVD LKAIEAAAWE IISCHNSGNN IYIVGNGGSA ATASHFACDL        60
     SKGARVPGQT PFRVLSLTDN MSLVTAWAND SSFEHVFAEQ LRPMIRQGDL LIVISASGNS       120
     PNVVFAAQVA RDLGARVLGL TGKDGGKLRN IANLTITVPT EHIEQVEDAH LVMAHCICFS       180
     IREYLTNKTI KIEDSALQQV FQANI                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page