(data stored in ACNUC7421 zone)

EMBL: CP001825.PE154

CP001825.PE154       Location/Qualifiers
FT   CDS             166131..167321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0156"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bha:BH0710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41078"
FT                   /db_xref="GOA:D1CDS2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS2"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41078.1"
FT                   /translation="MSEQVGFVTMAGQRATSKAPEVGVGMLGYAFMGKAHTNAFKKLPY
FT                   IVYPPPAIPRLVAIAGRNEEAVKEAASRYGYEGYYTDWRQMLDDDRIQLFDNGGPNYAH
FT                   AEPCIAAAQKGKHILCEKPLARNAQEAKAMLDAVNQAGVKAMVGFNYRFVPAVRLAYEM
FT                   IKNGELGEIYHFRAVYLQEWITDPEFPYIWRLDKELAGSGALGDLGAHIIDLGRHLIGE
FT                   VKSVMAMTRTFIPERNDPETGQRRKVEVDDAFEAVVEFENGAVGTLEASRFATGRKNHQ
FT                   VFEINGSKGSIRFNLERLNELEVYRTDAPKHTQGFTDVLVTESYHPFWSNWWPHGHIIG
FT                   WEHTFVHEIAHLLDCIVNDKDIAPYGATFEDGYRNAVICDAILQSAEEGKRVEVTF"
     MSEQVGFVTM AGQRATSKAP EVGVGMLGYA FMGKAHTNAF KKLPYIVYPP PAIPRLVAIA        60
     GRNEEAVKEA ASRYGYEGYY TDWRQMLDDD RIQLFDNGGP NYAHAEPCIA AAQKGKHILC       120
     EKPLARNAQE AKAMLDAVNQ AGVKAMVGFN YRFVPAVRLA YEMIKNGELG EIYHFRAVYL       180
     QEWITDPEFP YIWRLDKELA GSGALGDLGA HIIDLGRHLI GEVKSVMAMT RTFIPERNDP       240
     ETGQRRKVEV DDAFEAVVEF ENGAVGTLEA SRFATGRKNH QVFEINGSKG SIRFNLERLN       300
     ELEVYRTDAP KHTQGFTDVL VTESYHPFWS NWWPHGHIIG WEHTFVHEIA HLLDCIVNDK       360
     DIAPYGATFE DGYRNAVICD AILQSAEEGK RVEVTF                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page