(data stored in ACNUC7421 zone)

EMBL: CP001825.PE155

CP001825.PE155       Location/Qualifiers
FT   CDS             167357..168220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0157"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sus:Acid_2336 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41079"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACZ41079.1"
FT                   /translation="MARSRHPLMVTRTLLWRAYMFDLSGKVALVTGASKGIGQELAIAL
FT                   GKAGAAVVANYHTDRRGAEIAVEKVLEAGGNAVAVQGDISSVDQCRMLVSKTVETFGRI
FT                   DIACCHAGITSWGKFLDYTEEAFDAVVNTNLKGTYFTAQAAAREMIKQGGGGRIIITSS
FT                   VTGNQAVHYLSAYAMTKGGLQMLTRNLVLELSPYGITINAVAPGPIVNERNLHDDPEYE
FT                   TKWAKVVPMGRAGYPKDVASAVLFFASDEAEWITGTVLLVDGGWTCYSPTPDFEFVERE
FT                   GRIGTG"
     MARSRHPLMV TRTLLWRAYM FDLSGKVALV TGASKGIGQE LAIALGKAGA AVVANYHTDR        60
     RGAEIAVEKV LEAGGNAVAV QGDISSVDQC RMLVSKTVET FGRIDIACCH AGITSWGKFL       120
     DYTEEAFDAV VNTNLKGTYF TAQAAAREMI KQGGGGRIII TSSVTGNQAV HYLSAYAMTK       180
     GGLQMLTRNL VLELSPYGIT INAVAPGPIV NERNLHDDPE YETKWAKVVP MGRAGYPKDV       240
     ASAVLFFASD EAEWITGTVL LVDGGWTCYS PTPDFEFVER EGRIGTG                     287
//

If you have problems or comments...

PBIL Back to PBIL home page