(data stored in ACNUC7421 zone)

EMBL: CP001825.PE160

CP001825.PE160       Location/Qualifiers
FT   CDS             172968..174311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0162"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: acp:A2cp1_3045 protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41084"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDS8"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACZ41084.1"
FT                   /translation="MIRITDRSKGNLGNTTIKPAFDSHEPPSRELIDDCIHCGFCLPTC
FT                   PTYLLWGEEMDSPRGRIYLMKAALNGDPLTDSMVLHWDLCLGCMACVTACPSGVKYDRL
FT                   IEDTRYQVERRYPRALADRAFRKLIFEIFPHPNRLRAILPLLLFYRHSPLSKVLESRLL
FT                   SKLIPSRLRNLLELAPEVDPSQFSYKYPEKIPAKGKRRAKVGLITGCVQRIFFSHVNRA
FT                   TINVLSAEGCEVYIPRSQGCCGALALHSGNKDAARDFARSLINAFEGLDLDYIVINAAG
FT                   CGSTLKEYALLLQKDAIYRDRAKEFAGKIVDVSELLVKLGPVAKRHPLRIRVAYHDACH
FT                   LRHAQGIRKEPRELLTSIPELELVEPPEADICCGSAGIYNLLNPEAARELGERKLKNIS
FT                   STGAKYVASANPGCTLQISSIAQLHNQSFHIAHPVEYLEASILGKGIP"
     MIRITDRSKG NLGNTTIKPA FDSHEPPSRE LIDDCIHCGF CLPTCPTYLL WGEEMDSPRG        60
     RIYLMKAALN GDPLTDSMVL HWDLCLGCMA CVTACPSGVK YDRLIEDTRY QVERRYPRAL       120
     ADRAFRKLIF EIFPHPNRLR AILPLLLFYR HSPLSKVLES RLLSKLIPSR LRNLLELAPE       180
     VDPSQFSYKY PEKIPAKGKR RAKVGLITGC VQRIFFSHVN RATINVLSAE GCEVYIPRSQ       240
     GCCGALALHS GNKDAARDFA RSLINAFEGL DLDYIVINAA GCGSTLKEYA LLLQKDAIYR       300
     DRAKEFAGKI VDVSELLVKL GPVAKRHPLR IRVAYHDACH LRHAQGIRKE PRELLTSIPE       360
     LELVEPPEAD ICCGSAGIYN LLNPEAAREL GERKLKNISS TGAKYVASAN PGCTLQISSI       420
     AQLHNQSFHI AHPVEYLEAS ILGKGIP                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page