(data stored in ACNUC7421 zone)

EMBL: CP001825.PE162

CP001825.PE162       Location/Qualifiers
FT   CDS             175546..176451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0164"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sde:Sde_2639
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41086"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ41086.1"
FT                   /translation="MSSNNQVYGGIEAGGTKFVCAVGTGPDDIRSSITFPTTYPEETLE
FT                   KAVSFFRQATKGLTLVAIGIASFGPVDPNPLSPTYGYITSTPKPGWANTNFAGYIRESL
FT                   GVPVGFDTDTNVAALGEHRWGAAVGLETFIYLTVGTGIGGGGLVNGKLIHGMLHPEMGH
FT                   LAIPHDKEEDPFEGWCKFHKDCLEGLASGPAIESRWGVRGENLPADHPAWQLEAKYLAF
FT                   GLVNYIYTLSPQRIIMGGGVMQQSHLFPLIRQRVQHLLNGYIQADDVLQRIDQYIVPPK
FT                   LGTRAGVLGAIALAQDTVGD"
     MSSNNQVYGG IEAGGTKFVC AVGTGPDDIR SSITFPTTYP EETLEKAVSF FRQATKGLTL        60
     VAIGIASFGP VDPNPLSPTY GYITSTPKPG WANTNFAGYI RESLGVPVGF DTDTNVAALG       120
     EHRWGAAVGL ETFIYLTVGT GIGGGGLVNG KLIHGMLHPE MGHLAIPHDK EEDPFEGWCK       180
     FHKDCLEGLA SGPAIESRWG VRGENLPADH PAWQLEAKYL AFGLVNYIYT LSPQRIIMGG       240
     GVMQQSHLFP LIRQRVQHLL NGYIQADDVL QRIDQYIVPP KLGTRAGVLG AIALAQDTVG       300
     D                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page