(data stored in ACNUC7421 zone)

EMBL: CP001825.PE167

CP001825.PE167       Location/Qualifiers
FT   CDS             178387..179346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0169"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG:
FT                   bcb:BCB4264_A5061 UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41091"
FT                   /db_xref="GOA:D1CDT5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT5"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ACZ41091.1"
FT                   /translation="MPYQWHNNFVMKQSKIQTTNRYINSALFKHLYTIIVELRPKQWTK
FT                   NLLVFAGLVFSHNMLSLPALLRSSAAFVIFCAVSSAAYIINDLADVERDRLHPVKRLRP
FT                   IASGLISEPTAISIASLLLICSLIASFLLSWSFALVTVLYFLIVVLYSFYLKNVVLLDV
FT                   FSVASGFVLRAVAGTLVINVTLSSWLILCTLLLSLFLALAKRRHELLLLEEKASVHRQI
FT                   LNEYSRVFLDQLMAVVTSSTIIAYSLYTFSAASLPNDRSMMLTIPFVIYAIFRYLYLIY
FT                   QQNEGGNPETLLLQDKPLLISIVLWGIAVVLILYRPWA"
     MPYQWHNNFV MKQSKIQTTN RYINSALFKH LYTIIVELRP KQWTKNLLVF AGLVFSHNML        60
     SLPALLRSSA AFVIFCAVSS AAYIINDLAD VERDRLHPVK RLRPIASGLI SEPTAISIAS       120
     LLLICSLIAS FLLSWSFALV TVLYFLIVVL YSFYLKNVVL LDVFSVASGF VLRAVAGTLV       180
     INVTLSSWLI LCTLLLSLFL ALAKRRHELL LLEEKASVHR QILNEYSRVF LDQLMAVVTS       240
     STIIAYSLYT FSAASLPNDR SMMLTIPFVI YAIFRYLYLI YQQNEGGNPE TLLLQDKPLL       300
     ISIVLWGIAV VLILYRPWA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page