(data stored in ACNUC7421 zone)

EMBL: CP001825.PE168

CP001825.PE168       Location/Qualifiers
FT   CDS             179343..180560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0170"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase; deoxyribonuclease/rho
FT                   motif-related TRAM; KEGG: bha:BH0687 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41092"
FT                   /db_xref="GOA:D1CDT6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT6"
FT                   /inference="protein motif:TFAM:TIGR00479"
FT                   /protein_id="ACZ41092.1"
FT                   /translation="MTRNSVGKMMGINDSPATSIDQTVDLELHDMAHGGRALGRHEGMV
FT                   VFVPFGIPGERVLARIYHKHKRYAEAEIIDIITPSQDRVIPKCPYFGVCGGCHYQHIRY
FT                   DRQLEIKRHIVESLLSRIGGFRDIKVLPTIPSPREYYYRNSARFLCGQQGDLGFTDWRS
FT                   NSFIKVDTCPIMDEKINEVLQHIQGHGLPGENVRVRYSRQKDELVIWPKLSVDLETGQQ
FT                   FHTQVLLGREFRVSATSFFQVNTLQAENLIRIALDELEPLEGKTVVDAYCGVGTFTRFI
FT                   AERAELTIGIEESPSATADFRYNMQGLKAKLIEGRAEKELGRLPNNIDRLLLDPPRTGC
FT                   EPEALETILELAPEKIVYVSCDPATLARDLKVLCSTGAYRLKKVQPVDMFPQTFHIETI
FT                   ASLELL"
     MTRNSVGKMM GINDSPATSI DQTVDLELHD MAHGGRALGR HEGMVVFVPF GIPGERVLAR        60
     IYHKHKRYAE AEIIDIITPS QDRVIPKCPY FGVCGGCHYQ HIRYDRQLEI KRHIVESLLS       120
     RIGGFRDIKV LPTIPSPREY YYRNSARFLC GQQGDLGFTD WRSNSFIKVD TCPIMDEKIN       180
     EVLQHIQGHG LPGENVRVRY SRQKDELVIW PKLSVDLETG QQFHTQVLLG REFRVSATSF       240
     FQVNTLQAEN LIRIALDELE PLEGKTVVDA YCGVGTFTRF IAERAELTIG IEESPSATAD       300
     FRYNMQGLKA KLIEGRAEKE LGRLPNNIDR LLLDPPRTGC EPEALETILE LAPEKIVYVS       360
     CDPATLARDL KVLCSTGAYR LKKVQPVDMF PQTFHIETIA SLELL                       405
//

If you have problems or comments...

PBIL Back to PBIL home page