(data stored in ACNUC7421 zone)

EMBL: CP001825.PE17

CP001825.PE17        Location/Qualifiers
FT   CDS             18876..19841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0018"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: mlo:mlr7234 glucose
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40941"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDD5"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACZ40941.1"
FT                   /translation="MSNRYVIGVDLGGSRVRAVLANEKGEFLDRCEFPTLADKGLYFVL
FT                   ERILECVRSVSSNAPRIDAIGVGAPGPINSKEGVVSNPPNLPGWVNVPLAKLIEEKTGI
FT                   PTFLGNDANLAALGEFTYGSGKYVQHLIYITVSTGVGGGIIIDGQLLEGHNGAAGEVGH
FT                   MVVQPGGPKCSCGGYGHLEALSSGTAIAKRAREAASLNKDTIMIELAGSVDKINAKIVD
FT                   EAAKKGDPLALKLLEQAGQWLGYALINLIHIFNPQMISIGGGVSEAGELLLGPARKVVF
FT                   EGLMPVFKQDLQIVKASLGGDVGLAGAVALALQESAKSKV"
     MSNRYVIGVD LGGSRVRAVL ANEKGEFLDR CEFPTLADKG LYFVLERILE CVRSVSSNAP        60
     RIDAIGVGAP GPINSKEGVV SNPPNLPGWV NVPLAKLIEE KTGIPTFLGN DANLAALGEF       120
     TYGSGKYVQH LIYITVSTGV GGGIIIDGQL LEGHNGAAGE VGHMVVQPGG PKCSCGGYGH       180
     LEALSSGTAI AKRAREAASL NKDTIMIELA GSVDKINAKI VDEAAKKGDP LALKLLEQAG       240
     QWLGYALINL IHIFNPQMIS IGGGVSEAGE LLLGPARKVV FEGLMPVFKQ DLQIVKASLG       300
     GDVGLAGAVA LALQESAKSK V                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page