(data stored in ACNUC7421 zone)

EMBL: CP001825.PE171

CP001825.PE171       Location/Qualifiers
FT   CDS             complement(183644..184003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0173"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: aav:Aave_2238 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41095"
FT                   /db_xref="GOA:D1CDT9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDT9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACZ41095.1"
FT                   /translation="MLMKKVLIVDDEAEIVELIVMVLDDGQVQLLTAYDGEQAMRIIKE
FT                   QRPDVVLTDVMMPRLDGRELCKMVKSDPSISDTKVILMSAIHRLDKGDCPADGLIHKPF
FT                   DIVAIVEAVHKFLDQ"
     MLMKKVLIVD DEAEIVELIV MVLDDGQVQL LTAYDGEQAM RIIKEQRPDV VLTDVMMPRL        60
     DGRELCKMVK SDPSISDTKV ILMSAIHRLD KGDCPADGLI HKPFDIVAIV EAVHKFLDQ        119
//

If you have problems or comments...

PBIL Back to PBIL home page